NEK6 Antikörper
-
- Target Alle NEK6 Antikörper anzeigen
- NEK6 (NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NEK6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NEK6 antibody was raised using a synthetic peptide corresponding to a region with amino acids FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKAR
- Top Product
- Discover our top product NEK6 Primärantikörper
-
anti-NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) antibody
NEK6 Reaktivität: Human WB, IHC, IHC (p), IP Wirt: Maus Monoclonal 2H7 unconjugated
anti-NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) (AA 251-280), (C-Term) antibodyNEK6 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB34648 unconjugated
anti-NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) (N-Term) antibodyNEK6 Reaktivität: Human, Affe IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) antibodyNEK6 Reaktivität: Human WB, IHC Wirt: Kaninchen Monoclonal unconjugated
anti-NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) (AA 8-39), (N-Term) antibodyNEK6 Reaktivität: Human, Maus WB Wirt: Kaninchen Polyclonal RB2965 unconjugated
anti-NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) (AA 1-100) antibodyNEK6 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) (AA 1-100) antibodyNEK6 Reaktivität: Human ELISA, IF Wirt: Maus Monoclonal 3B5 unconjugated
anti-NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) (AA 38-87) antibodyNEK6 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Affe, Fledermaus, Huhn, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6) (N-Term) antibodyNEK6 Reaktivität: Human IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NEK6 Blocking Peptide, catalog no. 33R-3041, is also available for use as a blocking control in assays to test for specificity of this NEK6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEK6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NEK6 (NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6))
- Andere Bezeichnung
- NEK6 (NEK6 Produkte)
- Synonyme
- 1300007C09Rik antikoerper, si:ch211-167p9.4 antikoerper, ATNEK5 antikoerper, MOE17.17 antikoerper, NIMA-RELATED KINASE5 antikoerper, NIMA-related kinase 5 antikoerper, SID6-1512 antikoerper, NIMA (never in mitosis gene a)-related expressed kinase 6 antikoerper, NIMA-related kinase 6 antikoerper, NIMA related kinase 6 antikoerper, Serine/Threonine kinase catalytic domain protein antikoerper, NIMA-related kinase 6 S homeolog antikoerper, Nek6 antikoerper, nek6 antikoerper, NEK6 antikoerper, NEK5 antikoerper, nek6.S antikoerper
- Hintergrund
- The Aspergillus nidulans 'never in mitosis A' (NIMA) gene encodes a serine/threonine kinase that controls initiation of mitosis. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA.
- Molekulargewicht
- 36 kDa (MW of target protein)
-
