ADA Antikörper (Middle Region)
-
- Target Alle ADA Antikörper anzeigen
- ADA (Adenosine Deaminase (ADA))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ADA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ADA antibody was raised against the middle region of ADA
- Aufreinigung
- Affinity purified
- Immunogen
- ADA antibody was raised using the middle region of ADA corresponding to a region with amino acids ANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPE
- Top Product
- Discover our top product ADA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ADA Blocking Peptide, catalog no. 33R-1412, is also available for use as a blocking control in assays to test for specificity of this ADA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADA (Adenosine Deaminase (ADA))
- Andere Bezeichnung
- ADA (ADA Produkte)
- Synonyme
- ADA-like antikoerper, xada antikoerper, ADA antikoerper, CG11994 antikoerper, Dmel\\CG11994 antikoerper, DrosADA antikoerper, dADA antikoerper, zgc:92028 antikoerper, adenosine deaminase antikoerper, adenosine deaminase S homeolog antikoerper, Adenosine deaminase antikoerper, ADA antikoerper, Ada antikoerper, ada.S antikoerper, ada antikoerper
- Hintergrund
- ADA is an enzyme that catalyzes the hydrolysis of adenosine to inosine. Various mutations have been described for this gene and have been linked to human diseases. Deficiency in this enzyme causes a form of severe combined immunodeficiency disease (SCID), in which there is dysfunction of both B and T lymphocytes with impaired cellular immunity and decreased production of immunoglobulins, whereas elevated levels of this enzyme have been associated with congenital hemolytic anemia.
- Molekulargewicht
- 41 kDa (MW of target protein)
- Pathways
- Regulation of G-Protein Coupled Receptor Protein Signaling, Ribonucleoside Biosynthetic Process
-