RALGPS1 Antikörper (Middle Region)

Produktnummer ABIN634297

Produktdetails anti-RALGPS1 Antikörper

Target: RALGPS1 (Ral GEF with PH Domain and SH3 Binding Motif 1 (RALGPS1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RALGPS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RALGPS1 antibody was raised against the middle region of RALGPS1

Aufreinigung: Affinity purified

Immunogen: RALGPS1 antibody was raised using the middle region of RALGPS1 corresponding to a region with amino acids AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSATFPSEKARHLLDDSVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RALGPS1 Blocking Peptide, catalog no. 33R-1222, is also available for use as a blocking control in assays to test for specificity of this RALGPS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALGPS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RALGPS1

Target: RALGPS1 (Ral GEF with PH Domain and SH3 Binding Motif 1 (RALGPS1))

Andere Bezeichnung: RALGPS1 (RALGPS1 Produkte)

Synonyme: RALGEF2 antikoerper, RALGPS1A antikoerper, si:dkey-191c17.1 antikoerper, zgc:165535 antikoerper, 5830418G11Rik antikoerper, AI853783 antikoerper, AI854138 antikoerper, RalGEF 2 antikoerper, mKIAA0351 antikoerper, Ral GEF with PH domain and SH3 binding motif 1 antikoerper, RALGPS1 antikoerper, ralgps1 antikoerper, Ralgps1 antikoerper

Hintergrund: RALGPS1 contains 1 PH domain and 1 Ras-GEF domain. RALGPS1 may be involved in cytoskeletal organization. It may also be involved in the stimulation of transcription in a Ras-independent fashion Guanine nucleotide exchange factor for the small GTPase RALA.

Molekulargewicht: 62 kDa (MW of target protein)