GNAI2 Antikörper
-
- Target Alle GNAI2 Antikörper anzeigen
- GNAI2 (Guanine Nucleotide Binding Protein (G Protein), alpha Inhibiting Activity Polypeptide 2 (GNAI2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GNAI2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GNAI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDA
- Top Product
- Discover our top product GNAI2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GNAI2 Blocking Peptide, catalog no. 33R-2830, is also available for use as a blocking control in assays to test for specificity of this GNAI2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAI2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GNAI2 (Guanine Nucleotide Binding Protein (G Protein), alpha Inhibiting Activity Polypeptide 2 (GNAI2))
- Andere Bezeichnung
- GNAI2 (GNAI2 Produkte)
- Synonyme
- Galphai2 antikoerper, C76432 antikoerper, Gia antikoerper, Gnai-2 antikoerper, fi21e06 antikoerper, gnai2 antikoerper, wu:fi21e06 antikoerper, zgc:56690 antikoerper, gip antikoerper, gnai2b antikoerper, gnai3 antikoerper, GIP antikoerper, GNAI2B antikoerper, H_LUCA15.1 antikoerper, H_LUCA16.1 antikoerper, GBI2 antikoerper, gi2alpha antikoerper, Gnai2 antikoerper, gnai2l antikoerper, wu:fb10b04 antikoerper, wu:fb19c04 antikoerper, zgc:92609 antikoerper, G protein subunit alpha i2 antikoerper, guanine nucleotide binding protein (G protein), alpha inhibiting 2 antikoerper, guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2b antikoerper, guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 S homeolog antikoerper, guanine nucleotide-binding protein G(i) subunit alpha 2 antikoerper, guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2a antikoerper, Gnai2 antikoerper, gnai2b antikoerper, gnai2.S antikoerper, GNAI2 antikoerper, gnai2 antikoerper, gnai2a antikoerper
- Hintergrund
- Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process, G-protein mediated Events, Thromboxane A2 Receptor Signaling
-