ACPP Antikörper (Middle Region)

Produktnummer ABIN634280

Produktdetails anti-ACPP Antikörper

Target: ACPP (Acid Phosphatase, Prostate (ACPP))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACPP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACPP antibody was raised against the middle region of ACPP

Aufreinigung: Affinity purified

Immunogen: ACPP antibody was raised using the middle region of ACPP corresponding to a region with amino acids CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACPP Blocking Peptide, catalog no. 33R-1679, is also available for use as a blocking control in assays to test for specificity of this ACPP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACPP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACPP

Target: ACPP (Acid Phosphatase, Prostate (ACPP))

Andere Bezeichnung: ACPP (ACPP Produkte)

Synonyme: 5'-NT antikoerper, ACP-3 antikoerper, ACP3 antikoerper, PAP antikoerper, AMAP2 antikoerper, CENTB3 antikoerper, DDEF2 antikoerper, PAG3 antikoerper, Pap-alpha antikoerper, SHAG1 antikoerper, A030005E02Rik antikoerper, FRAP antikoerper, Lap antikoerper, Ppal antikoerper, Acpp11 antikoerper, RNACPP11 antikoerper, pap antikoerper, ACPP antikoerper, acp-3 antikoerper, acp3 antikoerper, acpt antikoerper, acid phosphatase, prostate antikoerper, ArfGAP with SH3 domain, ankyrin repeat and PH domain 2 antikoerper, prostatic acid phosphatase antikoerper, prostatic acid phosphatase, putative antikoerper, acid phosphatase, prostate S homeolog antikoerper, ACPP antikoerper, ASAP2 antikoerper, Acpp antikoerper, CpipJ_CPIJ004002 antikoerper, Smp_016640 antikoerper, acpp.S antikoerper

Hintergrund: This gene encodes an enzyme that catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and is secreted by the epithelial cells of the prostate gland.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: Synaptic Membrane, Ribonucleoside Biosynthetic Process