RFT1 Antikörper

Produktnummer ABIN634279

Produktdetails anti-RFT1 Antikörper

Target: RFT1 (RFT1 Homolog (RFT1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RFT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RFT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RFT1 Blocking Peptide, catalog no. 33R-3615, is also available for use as a blocking control in assays to test for specificity of this RFT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RFT1

Target: RFT1 (RFT1 Homolog (RFT1))

Andere Bezeichnung: RFT1 (RFT1 Produkte)

Synonyme: GB14370 antikoerper, CDG1N antikoerper, D930025H04 antikoerper, RGD1562654 antikoerper, protein RFT1 homolog antikoerper, RFT1 homolog antikoerper, LOC412489 antikoerper, LOC100453537 antikoerper, RFT1 antikoerper, rft1 antikoerper, LOC100633251 antikoerper, LOC100651701 antikoerper, Rft1 antikoerper

Hintergrund: N-glycosylation of proteins follows a highly conserved pathway that begins with the synthesis of aMan(5)GlcNAc(2)-dolichylpyrophosphate (PP-Dol) intermediate on the cytoplasmic side of the endoplasmic reticulum (ER) membrane followed by the translocation of Man(5)GlcNAc (2)-PP-Dol to the luminal side of the ER membrane. RFT1 is the flippase enzyme that catalyzes this translocation.

Molekulargewicht: 60 kDa (MW of target protein)