ABCF2 Antikörper
-
- Target Alle ABCF2 Antikörper anzeigen
- ABCF2 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 2 (ABCF2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ABCF2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ABCF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMEL
- Top Product
- Discover our top product ABCF2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ABCF2 Blocking Peptide, catalog no. 33R-2013, is also available for use as a blocking control in assays to test for specificity of this ABCF2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCF2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABCF2 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 2 (ABCF2))
- Andere Bezeichnung
- ABCF2 (ABCF2 Produkte)
- Synonyme
- abcf2 antikoerper, fc74f03 antikoerper, fd58d07 antikoerper, wu:fb04f06 antikoerper, wu:fc74f03 antikoerper, wu:fd58d07 antikoerper, MGC53054 antikoerper, ABCF2 antikoerper, DDBDRAFT_0185833 antikoerper, DDBDRAFT_0191228 antikoerper, DDB_0185833 antikoerper, DDB_0191228 antikoerper, DKFZp468L0120 antikoerper, ABC28 antikoerper, EST133090 antikoerper, HUSSY18 antikoerper, 0710005O05Rik antikoerper, Drr3 antikoerper, E430001O06 antikoerper, ABC transporter, class F antikoerper, ATP-binding cassette, sub-family F (GCN20), member 2a antikoerper, ATP binding cassette subfamily F member 2 L homeolog antikoerper, ATP binding cassette subfamily F member 2 antikoerper, ATP-binding cassette sub-family F member 2 antikoerper, ABC transporter-related protein antikoerper, ATP-binding cassette, sub-family F (GCN20), member 2 antikoerper, abcf-2 antikoerper, abcf2a antikoerper, abcf2.L antikoerper, ABCF2 antikoerper, LOC732866 antikoerper, ATEG_09303 antikoerper, LELG_02356 antikoerper, HCAG_02904 antikoerper, CpipJ_CPIJ002890 antikoerper, BDBG_04114 antikoerper, abcF2 antikoerper, PAAG_04904 antikoerper, abcf2 antikoerper, Abcf2 antikoerper
- Hintergrund
- The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This protein is a member of the GCN20 subfamily. Alternative splicing of this gene results in multiple transcript variants.
- Molekulargewicht
- 72 kDa (MW of target protein)
-