CCT7 Antikörper

Produktnummer ABIN634207

Produktdetails anti-CCT7 Antikörper

Target: CCT7 (Chaperonin Containing TCP1, Subunit 7 (Eta) (CCT7))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCT7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CCT7 antibody was raised using a synthetic peptide corresponding to a region with amino acids RAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCT7 Blocking Peptide, catalog no. 33R-7811, is also available for use as a blocking control in assays to test for specificity of this CCT7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCT7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCT7

Target: CCT7 (Chaperonin Containing TCP1, Subunit 7 (Eta) (CCT7))

Andere Bezeichnung: CCT7 (CCT7 Produkte)

Synonyme: Cct7 antikoerper, cct-eta antikoerper, ccth antikoerper, nip7-1 antikoerper, tcp-1-eta antikoerper, CCTETA antikoerper, CCTH antikoerper, NIP7-1 antikoerper, TCP1ETA antikoerper, CCT-ETA antikoerper, TCP-1-ETA antikoerper, AA408524 antikoerper, AL022769 antikoerper, Ccth antikoerper, Cctz antikoerper, chunp6934 antikoerper, fb38h02 antikoerper, fc05g05 antikoerper, wu:fb38h02 antikoerper, wu:fc05g05 antikoerper, chaperonin containing TCP1, subunit 7 (eta) antikoerper, chaperonin containing TCP1 subunit 7 antikoerper, chaperonin containing Tcp1, subunit 7 (eta) antikoerper, chaperonin containing TCP1 subunit 7 S homeolog antikoerper, Cct7 antikoerper, cct7 antikoerper, CCT7 antikoerper, cct7.S antikoerper

Hintergrund: CCT7 is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.

Molekulargewicht: 60 kDa (MW of target protein)