HSPA2 Antikörper (Middle Region)

Produktnummer ABIN634202

Produktdetails anti-HSPA2 Antikörper

Target: HSPA2 (Heat Shock 70kDa Protein 2 (HSPA2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSPA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HSPA2 antibody was raised against the middle region of HSPA2

Aufreinigung: Affinity purified

Immunogen: HSPA2 antibody was raised using the middle region of HSPA2 corresponding to a region with amino acids ITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSPA2 Blocking Peptide, catalog no. 33R-4180, is also available for use as a blocking control in assays to test for specificity of this HSPA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HSPA2

Target: HSPA2 (Heat Shock 70kDa Protein 2 (HSPA2))

Andere Bezeichnung: HSPA2 (HSPA2 Produkte)

Synonyme: HSP70-2 antikoerper, HSP70-3 antikoerper, HSPA2 antikoerper, DKFZp468B217 antikoerper, 70kDa antikoerper, HSP70.2 antikoerper, HSP70A2 antikoerper, Hsp70-2 antikoerper, Hspt70 antikoerper, Hst70 antikoerper, HSPA3 antikoerper, heat shock protein family A (Hsp70) member 2 antikoerper, heat shock protein Hsp20 antikoerper, heat shock 70kDa protein 2 antikoerper, heat shock protein 2 antikoerper, heat shock protein family A member 2 antikoerper, HSPA2 antikoerper, hspA2 antikoerper, Hspa2 antikoerper

Hintergrund: HSPA2 belongs to the heat shock protein 70 family. In cooperation with other chaperones, HSPA2 stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognise nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.

Molekulargewicht: 70 kDa (MW of target protein)