GINS2 Antikörper
-
- Target Alle GINS2 Antikörper anzeigen
- GINS2 (GINS Complex Subunit 2 (Psf2 Homolog) (GINS2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GINS2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GINS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAIN
- Top Product
- Discover our top product GINS2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GINS2 Blocking Peptide, catalog no. 33R-1841, is also available for use as a blocking control in assays to test for specificity of this GINS2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GINS2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GINS2 (GINS Complex Subunit 2 (Psf2 Homolog) (GINS2))
- Andere Bezeichnung
- GINS2 (GINS2 Produkte)
- Synonyme
- pfs2 antikoerper, psf2 antikoerper, hspc037 antikoerper, si:dkey-265o13.3 antikoerper, zgc:112262 antikoerper, HSPC037 antikoerper, PSF2 antikoerper, Pfs2 antikoerper, 2210013I18Rik antikoerper, 4833427B12Rik antikoerper, AI323585 antikoerper, RGD1311055 antikoerper, probable DNA replication complex GINS protein PSF2 antikoerper, GINS complex subunit 2 (Psf2 homolog) antikoerper, DNA replication complex GINS protein PSF2 antikoerper, GINS complex subunit 2 antikoerper, GINS complex subunit 2 (Psf2 homolog) L homeolog antikoerper, similar to C terminus of S. cerevisiae PSF2 (YJL072C) component of the GINS complex involved in DNA replication initiation; rest of gene upstream of small intron antikoerper, LOC408755 antikoerper, gins2 antikoerper, psf2 antikoerper, GINS2 antikoerper, Gins2 antikoerper, gins2.L antikoerper, PSF2 antikoerper
- Hintergrund
- The yeast heterotetrameric GINS complex is made up of Sld5, Psf1, Psf2, and Psf3. The formation of this complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts.
- Molekulargewicht
- 21 kDa (MW of target protein)
- Pathways
- DNA Replication, Synthesis of DNA
-