KIF9 Antikörper (N-Term)
-
- Target Alle KIF9 Antikörper anzeigen
- KIF9 (Kinesin Family Member 9 (KIF9))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KIF9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KIF9 antibody was raised against the n terminal of KIF9
- Aufreinigung
- Affinity purified
- Immunogen
- KIF9 antibody was raised using the N terminal of KIF9 corresponding to a region with amino acids MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQ
- Top Product
- Discover our top product KIF9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KIF9 Blocking Peptide, catalog no. 33R-6084, is also available for use as a blocking control in assays to test for specificity of this KIF9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIF9 (Kinesin Family Member 9 (KIF9))
- Andere Bezeichnung
- KIF9 (KIF9 Produkte)
- Synonyme
- RGD1565187 antikoerper, si:dkey-86l18.8 antikoerper, kinesin family member 9 antikoerper, si:dkey-86l18.8 antikoerper, KIF9 antikoerper, Kif9 antikoerper
- Hintergrund
- KIF9 acts as a regulator of podosomes and of podosomal matrix degradation in primary human macrophages.
- Molekulargewicht
- 75 kDa (MW of target protein)
-