BTG4 Antikörper (Middle Region)

Produktnummer ABIN634168

Produktdetails anti-BTG4 Antikörper

Target: BTG4 (B-Cell Translocation Gene 4 (BTG4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BTG4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BTG4 antibody was raised against the middle region of BTG4

Aufreinigung: Affinity purified

Immunogen: BTG4 antibody was raised using the middle region of BTG4 corresponding to a region with amino acids ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BTG4 Blocking Peptide, catalog no. 33R-4043, is also available for use as a blocking control in assays to test for specificity of this BTG4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTG4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BTG4

Target: BTG4 (B-Cell Translocation Gene 4 (BTG4))

Andere Bezeichnung: BTG4 (BTG4 Produkte)

Synonyme: SCIR-27 antikoerper, b9-a antikoerper, pc3b antikoerper, C86116 antikoerper, PC3B antikoerper, BTG anti-proliferation factor 4 antikoerper, BTG family member 4 L homeolog antikoerper, B cell translocation gene 4 antikoerper, Btg4 antikoerper, btg4.L antikoerper, BTG4 antikoerper

Hintergrund: The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle.

Molekulargewicht: 26 kDa (MW of target protein)