SPO11 Antikörper

Produktnummer ABIN634167

Produktdetails anti-SPO11 Antikörper

Target: SPO11 (SPO11 Meiotic Protein Covalently Bound To DSB Homolog (SPO11))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPO11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SPO11 antibody was raised using a synthetic peptide corresponding to a region with amino acids KFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPO11 Blocking Peptide, catalog no. 33R-4380, is also available for use as a blocking control in assays to test for specificity of this SPO11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPO11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPO11

Target: SPO11 (SPO11 Meiotic Protein Covalently Bound To DSB Homolog (SPO11))

Andere Bezeichnung: SPO11 (SPO11 Produkte)

Synonyme: CT35 antikoerper, SPATA43 antikoerper, TOPVIA antikoerper, zgc:77876 antikoerper, AI449549 antikoerper, Meiotic recombination protein spo-11 antikoerper, SPO11, initiator of meiotic double stranded breaks antikoerper, SPO11 meiotic protein covalently bound to DSB antikoerper, spo-11 antikoerper, SPO11 antikoerper, Spo11 antikoerper, spo11 antikoerper

Hintergrund: Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. SPO11 is similar in sequence and conserved features to the yeast meiotic recombination protein. It belongs to the TOP6A protein family.

Molekulargewicht: 44 kDa (MW of target protein)