MSH4 Antikörper
-
- Target Alle MSH4 Antikörper anzeigen
- MSH4 (MutS Homolog 4 (E. Coli) (MSH4))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MSH4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- MSH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSARDTNYPQTLKTPLSTGNPQRSGYKSWTPQVGYSASSSSAISAHSPSV
- Top Product
- Discover our top product MSH4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MSH4 Blocking Peptide, catalog no. 33R-8787, is also available for use as a blocking control in assays to test for specificity of this MSH4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSH4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MSH4 (MutS Homolog 4 (E. Coli) (MSH4))
- Andere Bezeichnung
- MSH4 (MSH4 Produkte)
- Synonyme
- MSH4 antikoerper, 4930485C04Rik antikoerper, AV144863 antikoerper, mMsh4 antikoerper, mutS homolog 4 antikoerper, mutS protein homolog 4 antikoerper, Msh4 antikoerper, MSH4 antikoerper, msh4 antikoerper, LOC575381 antikoerper, LOC100639599 antikoerper
- Hintergrund
- MSH4 is involved in meiotic recombination. MSH4 is also required for reciprocal recombination and proper segregation of homologous chromosomes at meiosis.
- Molekulargewicht
- 105 kDa (MW of target protein)
-