REC8 Antikörper

Produktnummer ABIN634121

Produktdetails anti-REC8 Antikörper

Target: REC8 (REC8 Homolog (Yeast) (REC8))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser REC8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Rec8 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Rec8 Blocking Peptide, catalog no. 33R-7641, is also available for use as a blocking control in assays to test for specificity of this Rec8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REC8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu REC8

Target: REC8 (REC8 Homolog (Yeast) (REC8))

Andere Bezeichnung: Rec8 (REC8 Produkte)

Synonyme: Rec8L1 antikoerper, mrec antikoerper, HR21spB antikoerper, REC8L1 antikoerper, Rec8p antikoerper, REC8 meiotic recombination protein antikoerper, REC8 homolog (yeast) antikoerper, REC8 antikoerper, Rec8 antikoerper

Hintergrund: REC8 is required during meiosis for separation of sister chromatids and homologous chromosomes. Proteolytic cleavage of REC8 on chromosome arms by separin during anaphase I allows for homologous chromosome separation in meiosis I and cleavage of REC8 on centromeres during anaphase II allows for sister chromatid separation in meiosis II.

Molekulargewicht: 62 kDa (MW of target protein)