CENPB Antikörper (C-Term)

Produktnummer ABIN634099

Produktdetails anti-CENPB Antikörper

Target: CENPB (Centromere Protein B (CENPB))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CENPB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CENPB antibody was raised against the C terminal of CENPB

Aufreinigung: Affinity purified

Immunogen: CENPB antibody was raised using the C terminal of CENPB corresponding to a region with amino acids GGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CENPB Blocking Peptide, catalog no. 33R-3277, is also available for use as a blocking control in assays to test for specificity of this CENPB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CENPB

Target: CENPB (Centromere Protein B (CENPB))

Andere Bezeichnung: CENPB (CENPB Produkte)

Synonyme: CENPB antikoerper, CENP-B antikoerper, centromere protein B antikoerper, centromere protein B, 80kDa antikoerper, CENPB antikoerper, Cenpb antikoerper

Hintergrund: CENPB is a highly conserved protein that facilitates centromere formation. It is a DNA-binding protein that is derived from transposases of the pogo DNA transposon family. It contains a helix-loop-helix DNA binding motif at the N-terminus, and a dimerization domain at the C-terminus. This protein is proposed to play an important role in the assembly of specific centromere structures in interphase nuclei and on mitotic chromosomes. It is also considered a major centromere autoantigen recognised by sera from patients with anti-centromere antibodies.

Molekulargewicht: 65 kDa (MW of target protein)