STAG3 Antikörper (Middle Region)

Produktnummer ABIN634086

Produktdetails anti-STAG3 Antikörper

Target: STAG3 (Stromal Antigen 3 (STAG3))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STAG3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: STAG3 antibody was raised against the middle region of STAG3

Aufreinigung: Affinity purified

Immunogen: STAG3 antibody was raised using the middle region of STAG3 corresponding to a region with amino acids VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAFCELCQS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STAG3 Blocking Peptide, catalog no. 33R-9729, is also available for use as a blocking control in assays to test for specificity of this STAG3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAG3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STAG3

Target: STAG3 (Stromal Antigen 3 (STAG3))

Andere Bezeichnung: STAG3 (STAG3 Produkte)

Synonyme: STAG3 antikoerper, SA-2 antikoerper, stromal antigen 3 antikoerper, STAG3 antikoerper, stag3 antikoerper, Stag3 antikoerper

Hintergrund: STAG3 is a meiosis specific component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The meiosis-specific cohesin complex probably replaces mitosis specific cohesin complex when it dissociates from chromatin during prophase I.

Molekulargewicht: 135 kDa (MW of target protein)