HS3ST1 Antikörper
-
- Target Alle HS3ST1 Antikörper anzeigen
- HS3ST1 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 1 (HS3ST1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HS3ST1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- HS3 ST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV
- Top Product
- Discover our top product HS3ST1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HS3ST1 Blocking Peptide, catalog no. 33R-9139, is also available for use as a blocking control in assays to test for specificity of this HS3ST1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HS3ST1 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 1 (HS3ST1))
- Andere Bezeichnung
- HS3ST1 (HS3ST1 Produkte)
- Synonyme
- 3OST1 antikoerper, 3OST antikoerper, 3-Ost antikoerper, D5Wsu110e antikoerper, Hsg3ost antikoerper, heparan sulfate-glucosamine 3-sulfotransferase 1 L homeolog antikoerper, heparan sulfate-glucosamine 3-sulfotransferase 1 antikoerper, heparan sulfate (glucosamine) 3-O-sulfotransferase 1 antikoerper, hs3st1.L antikoerper, HS3ST1 antikoerper, hs3st1 antikoerper, Hs3st1 antikoerper
- Hintergrund
- HS3ST1 is the rate limiting enzyme for synthesis of HSact. HS3ST1 performs the crucial step modification in the biosynthesis of anticoagulant heparan sulfate (HSact) that is to complete the structure of the antithrombin pentasaccharide binding site.Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities.
- Molekulargewicht
- 34 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-