ART4 Antikörper

Produktnummer ABIN634060

Produktdetails anti-ART4 Antikörper

Target: ART4 (ADP-Ribosyltransferase 4 (Dombrock Blood Group) (ART4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ART4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ART4 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLCYEVHYRTKDVHFNAYTGATIRFGQFLSTSLLKEEAQEFGNQTLFTIF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ART4 Blocking Peptide, catalog no. 33R-9161, is also available for use as a blocking control in assays to test for specificity of this ART4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ART4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ART4

Target: ART4 (ADP-Ribosyltransferase 4 (Dombrock Blood Group) (ART4))

Andere Bezeichnung: ART4 (ART4 Produkte)

Synonyme: ARTC4 antikoerper, CD297 antikoerper, DO antikoerper, DOK1 antikoerper, ATR4 antikoerper, 4432404K01Rik antikoerper, Dombrock antikoerper, ADP-ribosyltransferase 4 (Dombrock blood group) antikoerper, ADP-ribosyltransferase 4 antikoerper, ART4 antikoerper, Art4 antikoerper

Hintergrund: ART4 is a protein that contains a mono-ADP-ribosylation (ART) motif. It is a member of the ADP-ribosyltransferase gene family but enzymatic activity has not been demonstrated experimentally. Antigens of the Dombrock blood group system are located on the gene product, which is glycosylphosphatidylinosotol-anchored to the erythrocyte membrane. Allelic variants, some of which lead to adverse transfusion reactions, are known.

Molekulargewicht: 31 kDa (MW of target protein)