ASAH1 Antikörper

Produktnummer ABIN634057

Produktdetails anti-ASAH1 Antikörper

Target: ASAH1 (N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASAH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ASAH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASAH1 Blocking Peptide, catalog no. 33R-7724, is also available for use as a blocking control in assays to test for specificity of this ASAH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASAH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ASAH1

Target: ASAH1 (N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1))

Andere Bezeichnung: ASAH1 (ASAH1 Produkte)

Synonyme: AC antikoerper, ACDase antikoerper, ASAH antikoerper, PHP antikoerper, PHP32 antikoerper, SMAPME antikoerper, 2310081N20Rik antikoerper, Asah antikoerper, MGC82286 antikoerper, asah1 antikoerper, zgc:101637 antikoerper, ASAH1 antikoerper, zgc:66026 antikoerper, N-acylsphingosine amidohydrolase 1 antikoerper, N-acylsphingosine amidohydrolase (acid ceramidase) 1 antikoerper, N-acylsphingosine amidohydrolase (acid ceramidase) 1 L homeolog antikoerper, N-acylsphingosine amidohydrolase (acid ceramidase) 1a antikoerper, Acid ceramidase antikoerper, N-acylsphingosine amidohydrolase (acid ceramidase) 1b antikoerper, ASAH1 antikoerper, Asah1 antikoerper, asah1.L antikoerper, asah1a antikoerper, asah-1 antikoerper, asah1b antikoerper

Hintergrund: This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally.

Molekulargewicht: 14 kDa (MW of target protein)