DHRS9 Antikörper

Produktnummer ABIN634049

Produktdetails anti-DHRS9 Antikörper

Target: DHRS9 (Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHRS9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DHRS9 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DHRS9 Blocking Peptide, catalog no. 33R-2120, is also available for use as a blocking control in assays to test for specificity of this DHRS9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHRS9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DHRS9

Target: DHRS9 (Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9))

Andere Bezeichnung: DHRS9 (DHRS9 Produkte)

Synonyme: 3ALPHA-HSD antikoerper, RDH-TBE antikoerper, RDH15 antikoerper, RDHL antikoerper, RDHTBE antikoerper, RETSDR8 antikoerper, SDR9C4 antikoerper, Rdhl antikoerper, C730025I08Rik antikoerper, Rdh15 antikoerper, rdhl antikoerper, 3alpha-hsd antikoerper, rdh15 antikoerper, retsdr8 antikoerper, DHRS9 antikoerper, RDHA antikoerper, rdh1l antikoerper, wu:fb64b07 antikoerper, zgc:73286 antikoerper, dehydrogenase/reductase 9 antikoerper, dehydrogenase/reductase (SDR family) member 9 antikoerper, dehydrogenase/reductase (SDR family) member 9 L homeolog antikoerper, DHRS9 antikoerper, Dhrs9 antikoerper, dhrs9.L antikoerper, dhrs9 antikoerper

Hintergrund: DHRS9 is a 3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: C21-Steroid Hormone Metabolic Process