CTRP7 Antikörper (Middle Region)

Produktnummer ABIN634045

Produktdetails anti-CTRP7 Antikörper

Target: CTRP7 (C1QTNF7) (C1q and Tumor Necrosis Factor Related Protein 7 (C1QTNF7))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CTRP7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C1 QTNF7 antibody was raised against the middle region of C1 TNF7

Aufreinigung: Affinity purified

Immunogen: C1 QTNF7 antibody was raised using the middle region of C1 TNF7 corresponding to a region with amino acids SIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1QTNF7 Blocking Peptide, catalog no. 33R-8542, is also available for use as a blocking control in assays to test for specificity of this C1QTNF7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 TNF7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CTRP7

Target: CTRP7 (C1QTNF7) (C1q and Tumor Necrosis Factor Related Protein 7 (C1QTNF7))

Andere Bezeichnung: C1QTNF7 (C1QTNF7 Produkte)

Synonyme: C1QTNF7 antikoerper, 5530401N20Rik antikoerper, 8430425G24Rik antikoerper, Ctrp7 antikoerper, CTRP7 antikoerper, ZACRP7 antikoerper, C1q and tumor necrosis factor related protein 7 antikoerper, C1q and TNF related 7 antikoerper, C1QTNF7 antikoerper, C1qtnf7 antikoerper

Hintergrund: The specific function of C1QTNF7 is not yet known.

Molekulargewicht: 31 kDa (MW of target protein)