PLA1A Antikörper (Middle Region)
-
- Target Alle PLA1A Antikörper anzeigen
- PLA1A (Phospholipase A1 Member A (PLA1A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PLA1A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PLA1 A antibody was raised against the middle region of PLA1
- Aufreinigung
- Affinity purified
- Immunogen
- PLA1 A antibody was raised using the middle region of PLA1 corresponding to a region with amino acids TDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLY
- Top Product
- Discover our top product PLA1A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PLA1A Blocking Peptide, catalog no. 33R-9022, is also available for use as a blocking control in assays to test for specificity of this PLA1A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLA0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLA1A (Phospholipase A1 Member A (PLA1A))
- Andere Bezeichnung
- PLA1A (PLA1A Produkte)
- Synonyme
- PS-PLA1 antikoerper, PSPLA1 antikoerper, AA986889 antikoerper, Ps-pla1 antikoerper, Pspla1 antikoerper, wu:fi26h09 antikoerper, zgc:77160 antikoerper, AH antikoerper, ARWH2 antikoerper, LAH2 antikoerper, LPDLR antikoerper, PLA1B antikoerper, mPA-PLA1 antikoerper, phospholipase A1 member A antikoerper, lipase H antikoerper, PLA1A antikoerper, Pla1a antikoerper, pla1a antikoerper, CpipJ_CPIJ002492 antikoerper, CpipJ_CPIJ007883 antikoerper, LIPH antikoerper
- Hintergrund
- Phosphatidylserine-specific phospholipase A1-alpha (PLA1A) acts specifically on phosphatidylserine (PS) and 1-acyl-2-lysophosphatidylserine (lyso-PS) to hydrolyze fatty acids at the sn-1 position of these phospholipids.
- Molekulargewicht
- 50 kDa (MW of target protein)
-