Elastase 4 Antikörper

Produktnummer ABIN634038

Produktdetails anti-Elastase 4 Antikörper

Target: Elastase 4 (CTRC) (Chymotrypsin C (Caldecrin) (CTRC))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Elastase 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Chymotrypsin C antibody was raised using a synthetic peptide corresponding to a region with amino acids LGITVLAALLACASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Chymotrypsin C Blocking Peptide, catalog no. 33R-4977, is also available for use as a blocking control in assays to test for specificity of this Chymotrypsin C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTRC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Elastase 4

Target: Elastase 4 (CTRC) (Chymotrypsin C (Caldecrin) (CTRC))

Andere Bezeichnung: Chymotrypsin C (CTRC Produkte)

Synonyme: CLCR antikoerper, ELA4 antikoerper, 1810044E12Rik antikoerper, bPTLP antikoerper, chymotrypsin C antikoerper, chymotrypsin-C antikoerper, chymotrypsin C (caldecrin) antikoerper, CTRC antikoerper, LOC478220 antikoerper, Ctrc antikoerper

Hintergrund: CTRC is a member of the peptidase S1 family. The protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. This gene encodes a member of the peptidase S1 family. The encoded protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined.

Molekulargewicht: 27 kDa (MW of target protein)