STATH Antikörper (Middle Region)

Produktnummer ABIN634026

Produktdetails anti-STATH Antikörper

Target: STATH (Statherin (STATH))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STATH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: STATH antibody was raised against the middle region of STATH

Aufreinigung: Affinity purified

Immunogen: STATH antibody was raised using the middle region of STATH corresponding to a region with amino acids MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STATH Blocking Peptide, catalog no. 33R-6136, is also available for use as a blocking control in assays to test for specificity of this STATH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STATH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STATH

Target: STATH (Statherin (STATH))

Andere Bezeichnung: STATH (STATH Produkte)

Synonyme: STR antikoerper, statherin antikoerper, STATH antikoerper

Hintergrund: STATH is a salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface.

Molekulargewicht: 7 kDa (MW of target protein)