RDH12 Antikörper
-
- Target Alle RDH12 Antikörper anzeigen
- RDH12 (Retinol Dehydrogenase 12 (All-Trans/9-Cis/11-Cis) (RDH12))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RDH12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RDH12 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFVKTAREGAQT
- Top Product
- Discover our top product RDH12 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RDH12 Blocking Peptide, catalog no. 33R-1308, is also available for use as a blocking control in assays to test for specificity of this RDH12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RDH12 (Retinol Dehydrogenase 12 (All-Trans/9-Cis/11-Cis) (RDH12))
- Andere Bezeichnung
- RDH12 (RDH12 Produkte)
- Synonyme
- wu:fj43a10 antikoerper, zgc:92430 antikoerper, A930033N07Rik antikoerper, LCA13 antikoerper, LCA3 antikoerper, RP53 antikoerper, SDR7C2 antikoerper, DSSDR2 antikoerper, retinol dehydrogenase 12 (all-trans/9-cis/11-cis) antikoerper, retinol dehydrogenase 12 antikoerper, Retinol dehydrogenase 12 antikoerper, RDH12 antikoerper, rdh12 antikoerper, MAV_1968 antikoerper, CC1G_02720 antikoerper, Bm1_36660 antikoerper, PTRG_03574 antikoerper, PTRG_05326 antikoerper, PTRG_08067 antikoerper, LOC100282710 antikoerper, LOC100285880 antikoerper, LOC100226769 antikoerper, Rdh12 antikoerper
- Hintergrund
- RDH12 is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. RDH12 also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3). The protein encoded by this gene is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. The encoded enzyme also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3).
- Molekulargewicht
- 35 kDa (MW of target protein)
-