Haptoglobin Antikörper (Middle Region)
-
- Target Alle Haptoglobin (HP) Antikörper anzeigen
- Haptoglobin (HP)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Haptoglobin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Haptoglobin antibody was raised against the middle region of HP
- Aufreinigung
- Affinity purified
- Immunogen
- Haptoglobin antibody was raised using the middle region of HP corresponding to a region with amino acids NANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNE
- Top Product
- Discover our top product HP Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.0125 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Haptoglobin Blocking Peptide, catalog no. 33R-6640, is also available for use as a blocking control in assays to test for specificity of this Haptoglobin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Haptoglobin (HP)
- Andere Bezeichnung
- Haptoglobin (HP Produkte)
- Synonyme
- HP antikoerper, wu:fb64e01 antikoerper, BP antikoerper, HP2ALPHA2 antikoerper, HPA1S antikoerper, HP-1 antikoerper, HPR antikoerper, Zonulin antikoerper, haptoglobin antikoerper, haptoglobin-like antikoerper, HP antikoerper, hp antikoerper, Hp antikoerper, LOC479668 antikoerper, LOC101102413 antikoerper
- Hintergrund
- This gene encodes a preproprotein, which is processed to yield both alpha and beta chains, which subsequently combine as a tetramer to produce haptoglobin. Haptoglobin functions to bind free plasma hemoglobin.
- Molekulargewicht
- 45 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-