CETP Antikörper (Middle Region)
-
- Target Alle CETP Antikörper anzeigen
- CETP (Cholesteryl Ester Transfer Protein (CETP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CETP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CETP antibody was raised against the middle region of CETP
- Aufreinigung
- Affinity purified
- Immunogen
- CETP antibody was raised using the middle region of CETP corresponding to a region with amino acids KKLFLSLLDFQITPKTVSNLTESSSESVQSFLQSMITAVGIPEVMSRLEV
- Top Product
- Discover our top product CETP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CETP Blocking Peptide, catalog no. 33R-4481, is also available for use as a blocking control in assays to test for specificity of this CETP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CETP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CETP (Cholesteryl Ester Transfer Protein (CETP))
- Andere Bezeichnung
- CETP (CETP Produkte)
- Synonyme
- BPIFF antikoerper, HDLCQ10 antikoerper, hdlcq10 antikoerper, cholesteryl ester transfer protein antikoerper, cholesteryl ester transfer protein L homeolog antikoerper, CETP antikoerper, cetp.L antikoerper, Cetp antikoerper
- Hintergrund
- CETP involved in the transfer of insoluble cholesteryl esters in the reverse transport of cholesterol. Defects in CETP are a cause of hyperalphalipoproteinemia. Cholesteryl ester transfer protein (CETP) transfers cholesteryl esters between lipoproteins. CETP may effect susceptibility to atherosclerosis.
- Molekulargewicht
- 53 kDa (MW of target protein)
-