CYP2B6 Antikörper (Middle Region)

Produktnummer ABIN633985

Produktdetails anti-CYP2B6 Antikörper

Target: CYP2B6 (Cytochrome P450, Family 2, Subfamily B, Polypeptide 6 (CYP2B6))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP2B6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYP2 B6 antibody was raised against the middle region of CYP2 6

Aufreinigung: Affinity purified

Immunogen: CYP2 B6 antibody was raised using the middle region of CYP2 6 corresponding to a region with amino acids QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP2B6 Blocking Peptide, catalog no. 33R-7624, is also available for use as a blocking control in assays to test for specificity of this CYP2B6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP2B6

Target: CYP2B6 (Cytochrome P450, Family 2, Subfamily B, Polypeptide 6 (CYP2B6))

Andere Bezeichnung: CYP2B6 (CYP2B6 Produkte)

Synonyme: CPB6 antikoerper, CYP2B antikoerper, CYP2B7 antikoerper, CYP2B7P antikoerper, CYPIIB6 antikoerper, EFVM antikoerper, IIB1 antikoerper, P450 antikoerper, CPF3 antikoerper, CYP4F antikoerper, LTB4H antikoerper, CYP2B30 antikoerper, CYP2B11 antikoerper, CYPIIB11 antikoerper, 21-OH antikoerper, 21OH antikoerper, 21OHA antikoerper, 21OHB antikoerper, CYP21OH-A antikoerper, Cyp21 antikoerper, Cyp21-ps1 antikoerper, Cyp21B antikoerper, Cyp21a2-ps antikoerper, Cyp21a2ps antikoerper, Oh21-1 antikoerper, Oh21-2 antikoerper, CYP2B6 antikoerper, cytochrome P450 family 2 subfamily B member 6 antikoerper, cytochrome P450 family 4 subfamily F member 3 antikoerper, cytochrome P450, family 2, subfamily B, polypeptide 6 antikoerper, cytochrome P450 family 2 subfamily B member 6 L homeolog antikoerper, cytochrome P450 2B11 antikoerper, cytochrome P450, family 21, subfamily a, polypeptide 1 antikoerper, cytochrome P450 subfamily 2B antikoerper, cytochrome P450 2B11-like antikoerper, CYP2B6 antikoerper, CYP4F3 antikoerper, cyp2b6.L antikoerper, Cyp21a1 antikoerper, LOC100068603 antikoerper

Hintergrund: This gene, CYP2B6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Molekulargewicht: 56 kDa (MW of target protein)