CYP2C18 Antikörper (N-Term)

Produktnummer ABIN633982

Produktdetails anti-CYP2C18 Antikörper

Target: CYP2C18 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 18 (CYP2C18))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP2C18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYP2 C18 antibody was raised against the N terminal of CYP2 18

Aufreinigung: Affinity purified

Immunogen: CYP2 C18 antibody was raised using the N terminal of CYP2 18 corresponding to a region with amino acids MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP2C18 Blocking Peptide, catalog no. 33R-5855, is also available for use as a blocking control in assays to test for specificity of this CYP2C18 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 18 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP2C18

Target: CYP2C18 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 18 (CYP2C18))

Andere Bezeichnung: CYP2C18 (CYP2C18 Produkte)

Synonyme: CPCJ antikoerper, CYP2C antikoerper, P450C2C antikoerper, P450IIC19 antikoerper, CPCI antikoerper, CYP2C17 antikoerper, P450-6B/29C antikoerper, P450IIC17 antikoerper, cpci antikoerper, cyp2c antikoerper, cyp2c17 antikoerper, p450-6b/29c antikoerper, p450iic17 antikoerper, CYP2C18 antikoerper, MGC139147 antikoerper, cytochrome P450 family 2 subfamily C member 19 antikoerper, cytochrome P450 family 2 subfamily C member 18 antikoerper, cytochrome P450 family 2 subfamily C member 18 L homeolog antikoerper, cytochrome P450, family 2, subfamily C, polypeptide 18 antikoerper, CYP2C19 antikoerper, CYP2C18 antikoerper, cyp2c18.L antikoerper, cyp2c18 antikoerper

Hintergrund: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Molekulargewicht: 56 kDa (MW of target protein)