CYP2C18 Antikörper (N-Term)
-
- Target Alle CYP2C18 Antikörper anzeigen
- CYP2C18 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 18 (CYP2C18))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CYP2C18 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CYP2 C18 antibody was raised against the N terminal of CYP2 18
- Aufreinigung
- Affinity purified
- Immunogen
- CYP2 C18 antibody was raised using the N terminal of CYP2 18 corresponding to a region with amino acids MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM
- Top Product
- Discover our top product CYP2C18 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CYP2C18 Blocking Peptide, catalog no. 33R-5855, is also available for use as a blocking control in assays to test for specificity of this CYP2C18 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 18 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP2C18 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 18 (CYP2C18))
- Andere Bezeichnung
- CYP2C18 (CYP2C18 Produkte)
- Synonyme
- CPCJ antikoerper, CYP2C antikoerper, P450C2C antikoerper, P450IIC19 antikoerper, CPCI antikoerper, CYP2C17 antikoerper, P450-6B/29C antikoerper, P450IIC17 antikoerper, cpci antikoerper, cyp2c antikoerper, cyp2c17 antikoerper, p450-6b/29c antikoerper, p450iic17 antikoerper, CYP2C18 antikoerper, MGC139147 antikoerper, cytochrome P450 family 2 subfamily C member 19 antikoerper, cytochrome P450 family 2 subfamily C member 18 antikoerper, cytochrome P450 family 2 subfamily C member 18 L homeolog antikoerper, cytochrome P450, family 2, subfamily C, polypeptide 18 antikoerper, CYP2C19 antikoerper, CYP2C18 antikoerper, cyp2c18.L antikoerper, cyp2c18 antikoerper
- Hintergrund
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.
- Molekulargewicht
- 56 kDa (MW of target protein)
-