TFPI2 Antikörper (Middle Region)

Produktnummer ABIN633956

Produktdetails anti-TFPI2 Antikörper

Target: TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TFPI2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TFPI2 antibody was raised against the middle region of TFPI2

Aufreinigung: Affinity purified

Immunogen: TFPI2 antibody was raised using the middle region of TFPI2 corresponding to a region with amino acids NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TFPI2 Blocking Peptide, catalog no. 33R-6642, is also available for use as a blocking control in assays to test for specificity of this TFPI2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFPI2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TFPI2

Target: TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))

Andere Bezeichnung: TFPI2 (TFPI2 Produkte)

Synonyme: MGC68843 antikoerper, TFPI2 antikoerper, MGC108301 antikoerper, si:ch211-262k23.2 antikoerper, tfpi2 antikoerper, PP5 antikoerper, REF1 antikoerper, TFPI-2 antikoerper, AV000670 antikoerper, PP5/TFPI-2 antikoerper, tissue factor pathway inhibitor 2 L homeolog antikoerper, tissue factor pathway inhibitor 2 antikoerper, tfpi2.L antikoerper, TFPI2 antikoerper, tfpi2 antikoerper, Tfpi2 antikoerper

Hintergrund: TFPI2 may play a role in the regulation of plasmin-mediated matrix remodeling. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 has no effect on thrombin.

Molekulargewicht: 26 kDa (MW of target protein)