OXCT2 Antikörper (Middle Region)

Produktnummer ABIN633946

Produktdetails anti-OXCT2 Antikörper

Target: OXCT2 (3-Oxoacid CoA Transferase 2 (OXCT2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OXCT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OXCT2 antibody was raised against the middle region of OXCT2

Aufreinigung: Affinity purified

Immunogen: OXCT2 antibody was raised using the middle region of OXCT2 corresponding to a region with amino acids GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OXCT2 Blocking Peptide, catalog no. 33R-3340, is also available for use as a blocking control in assays to test for specificity of this OXCT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXCT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OXCT2

Target: OXCT2 (3-Oxoacid CoA Transferase 2 (OXCT2))

Andere Bezeichnung: OXCT2 (OXCT2 Produkte)

Synonyme: SCOTT antikoerper, Oxct antikoerper, Oxct2 antikoerper, Scot antikoerper, Scot-t1 antikoerper, 3-oxoacid CoA-transferase 2 antikoerper, succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial antikoerper, 3-oxoacid CoA transferase 2A antikoerper, OXCT2 antikoerper, LOC100341106 antikoerper, Oxct2a antikoerper, Oxct2 antikoerper

Hintergrund: OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC 2.8.3.5), which catalyzes the reversible transferof CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization.OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC 2.8.3.5), which catalyzes the reversible transfer of CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization.

Molekulargewicht: 56 kDa (MW of target protein)