OXCT2 Antikörper (Middle Region)

Produktnummer ABIN633946

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch OXCT2 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für OXCT2 Antikörper (Middle Region) (ABIN633946)

Target: OXCT2 (3-Oxoacid CoA Transferase 2 (OXCT2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OXCT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-OXCT2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: OXCT2 antibody was raised against the middle region of OXCT2

Aufreinigung: Affinity purified

Immunogen: OXCT2 antibody was raised using the middle region of OXCT2 corresponding to a region with amino acids GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OXCT2 Blocking Peptide, (ABIN938726), is also available for use as a blocking control in assays to test for specificity of this OXCT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXCT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OXCT2

Target: OXCT2 (3-Oxoacid CoA Transferase 2 (OXCT2))

Andere Bezeichnung: OXCT2

Hintergrund: OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC 2.8.3.5), which catalyzes the reversible transferof CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization.OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC 2.8.3.5), which catalyzes the reversible transfer of CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization.

Molekulargewicht: 56 kDa (MW of target protein)