OXCT2 Antikörper (Middle Region)
-
- Target Alle OXCT2 Antikörper anzeigen
- OXCT2 (3-Oxoacid CoA Transferase 2 (OXCT2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser OXCT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- OXCT2 antibody was raised against the middle region of OXCT2
- Aufreinigung
- Affinity purified
- Immunogen
- OXCT2 antibody was raised using the middle region of OXCT2 corresponding to a region with amino acids GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV
- Top Product
- Discover our top product OXCT2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
OXCT2 Blocking Peptide, catalog no. 33R-3340, is also available for use as a blocking control in assays to test for specificity of this OXCT2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXCT2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OXCT2 (3-Oxoacid CoA Transferase 2 (OXCT2))
- Andere Bezeichnung
- OXCT2 (OXCT2 Produkte)
- Synonyme
- SCOTT antikoerper, Oxct antikoerper, Oxct2 antikoerper, Scot antikoerper, Scot-t1 antikoerper, 3-oxoacid CoA-transferase 2 antikoerper, succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial antikoerper, 3-oxoacid CoA transferase 2A antikoerper, OXCT2 antikoerper, LOC100341106 antikoerper, Oxct2a antikoerper, Oxct2 antikoerper
- Hintergrund
- OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC 2.8.3.5), which catalyzes the reversible transferof CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization.OXCT2 is a testis-specific succinyl-CoA:3-oxoacid CoA transferase (EC 2.8.3.5), which catalyzes the reversible transfer of CoA from succinyl-CoA to acetoacetate in the first step of ketone body utilization.
- Molekulargewicht
- 56 kDa (MW of target protein)
-