CHST6 Antikörper
-
- Target Alle CHST6 Antikörper anzeigen
- CHST6 (Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 6 (CHST6))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHST6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CHST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids QELCAGALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN
- Top Product
- Discover our top product CHST6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHST6 Blocking Peptide, catalog no. 33R-7529, is also available for use as a blocking control in assays to test for specificity of this CHST6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHST6 (Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 6 (CHST6))
- Andere Bezeichnung
- CHST6 (CHST6 Produkte)
- Synonyme
- mcdc1 antikoerper, MCDC1 antikoerper, carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 6 L homeolog antikoerper, carbohydrate sulfotransferase 6 antikoerper, carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 6 antikoerper, chst6.L antikoerper, LOC711570 antikoerper, CHST6 antikoerper, LOC100477677 antikoerper, LOC489707 antikoerper
- Hintergrund
- CHST6 catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues of keratan. It mediates sulfation of keratan in cornea. Keratan sulfate plays a central role in maintaining corneal transparency. CHST6 acts on the non-reducing terminal GlcNAc of short and long carbohydrate substrates that have poly-N-acetyllactosamine structures.
- Molekulargewicht
- 44 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-