FGL1 Antikörper (Middle Region)
-
- Target Alle FGL1 Antikörper anzeigen
- FGL1 (Fibrinogen-Like 1 (FGL1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FGL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FGL1 antibody was raised against the middle region of FGL1
- Aufreinigung
- Affinity purified
- Immunogen
- FGL1 antibody was raised using the middle region of FGL1 corresponding to a region with amino acids EFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWL
- Top Product
- Discover our top product FGL1 Primärantikörper
-
anti-Fibrinogen-Like 1 (FGL1) (AA 23-314) antibody
FGL1 Reaktivität: Ratte WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Fibrinogen-Like 1 (FGL1) (AA 23-312) antibodyFGL1 Reaktivität: Human WB, IHC, ELISA, ICC, FACS Wirt: Maus Monoclonal 4F9C11 unconjugated
anti-Fibrinogen-Like 1 (FGL1) (AA 23-312) antibodyFGL1 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Fibrinogen-Like 1 (FGL1) (AA 19-312) antibodyFGL1 Reaktivität: Human WB, ELISA, IP Wirt: Maus Monoclonal 2A4 unconjugated
anti-Fibrinogen-Like 1 (FGL1) (AA 23-314) antibodyFGL1 Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Fibrinogen-Like 1 (FGL1) (AA 23-312) antibodyFGL1 Reaktivität: Human WB, IHC, IP, ICC Wirt: Maus Monoclonal C5 unconjugated
anti-Fibrinogen-Like 1 (FGL1) (AA 179-282) antibodyFGL1 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Fibrinogen-Like 1 (FGL1) (AA 218-247), (C-Term) antibodyFGL1 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB19507 unconjugated
anti-Fibrinogen-Like 1 (FGL1) antibodyFGL1 Reaktivität: Human, Maus, Ratte WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Fibrinogen-Like 1 (FGL1) (AA 1-312) antibodyFGL1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FGL1 Blocking Peptide, catalog no. 33R-2413, is also available for use as a blocking control in assays to test for specificity of this FGL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FGL1 (Fibrinogen-Like 1 (FGL1))
- Andere Bezeichnung
- FGL1 (FGL1 Produkte)
- Synonyme
- MGC84748 antikoerper, FGL1 antikoerper, DKFZp470A2333 antikoerper, Frep1 antikoerper, Lfire1 antikoerper, HFREP1 antikoerper, HP-041 antikoerper, LFIRE-1 antikoerper, LFIRE1 antikoerper, Mfire1 antikoerper, fibrinogen like 1 L homeolog antikoerper, fibrinogen like 1 antikoerper, fibrinogen-like 1 antikoerper, fibrinogen-like protein 1 antikoerper, fgl1.L antikoerper, FGL1 antikoerper, Fgl1 antikoerper
- Hintergrund
- Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins.
- Molekulargewicht
- 34 kDa (MW of target protein)
-
