FGL1 Antikörper (Middle Region)

Produktnummer ABIN633938

Der Kaninchen Polyklonal anti-FGL1 Antikörper wird verwendet zum Nachweis von FGL1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für FGL1 Antikörper (Middle Region) (ABIN633938)

Target: FGL1 (Fibrinogen-Like 1 (FGL1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FGL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FGL1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: FGL1 antibody was raised against the middle region of FGL1

Aufreinigung: Affinity purified

Immunogen: FGL1 antibody was raised using the middle region of FGL1 corresponding to a region with amino acids EFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FGL1 Blocking Peptide, (ABIN937799), is also available for use as a blocking control in assays to test for specificity of this FGL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FGL1

Target: FGL1 (Fibrinogen-Like 1 (FGL1))

Andere Bezeichnung: FGL1

Hintergrund: Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins.

Molekulargewicht: 34 kDa (MW of target protein)