SERPINC1 Antikörper
-
- Target Alle SERPINC1 Antikörper anzeigen
- SERPINC1 (Serpin Family C Member 1 (SERPINC1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SERPINC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SERPINC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD
- Top Product
- Discover our top product SERPINC1 Primärantikörper
-
anti-Serpin Family C Member 1 (SERPINC1) antibody
SERPINC1 Reaktivität: Human WB, IHC, IP, ICC Wirt: Maus Monoclonal C3 unconjugated
anti-Serpin Family C Member 1 (SERPINC1) (AA 150-426) antibodySERPINC1 Reaktivität: Ratte WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Serpin Family C Member 1 (SERPINC1) (AA 33-465) antibodySERPINC1 Reaktivität: Rind (Kuh) WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Serpin Family C Member 1 (SERPINC1) (AA 33-465) antibodySERPINC1 Reaktivität: Ratte WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Serpin Family C Member 1 (SERPINC1) (AA 364-393), (C-Term) antibodySERPINC1 Reaktivität: Human, Maus WB, IF, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB18489 unconjugated
anti-Serpin Family C Member 1 (SERPINC1) (AA 1-259) antibodySERPINC1 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 2B12 unconjugated
anti-Serpin Family C Member 1 (SERPINC1) (AA 37-180) antibodySERPINC1 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Serpin Family C Member 1 (SERPINC1) (AA 33-185) antibodySERPINC1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Serpin Family C Member 1 (SERPINC1) antibodySERPINC1 Reaktivität: Human WB, IHC Wirt: Kaninchen Monoclonal unconjugated
anti-Serpin Family C Member 1 (SERPINC1) antibodySERPINC1 Reaktivität: Human WB, IHC, IP, ICC Wirt: Maus Monoclonal C2 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SERPINC1 Blocking Peptide, catalog no. 33R-4150, is also available for use as a blocking control in assays to test for specificity of this SERPINC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SERPINC1 (Serpin Family C Member 1 (SERPINC1))
- Andere Bezeichnung
- SERPINC1 (SERPINC1 Produkte)
- Synonyme
- AT3 antikoerper, AT3D antikoerper, ATIII antikoerper, THPH7 antikoerper, SERPINC1 antikoerper, DKFZp470C1733 antikoerper, AI114908 antikoerper, At-3 antikoerper, At3 antikoerper, ANTITHROMBIN, AT-III antikoerper, AT-III antikoerper, serpin family C member 1 antikoerper, antithrombin-III antikoerper, serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 antikoerper, SERPINC1 antikoerper, CpipJ_CPIJ000472 antikoerper, CpipJ_CPIJ013111 antikoerper, Serpinc1 antikoerper
- Hintergrund
- The protein encoded by this gene is a plasma protease inhibitor and a member of the serpin superfamily. This protein inhibits thrombin as well as other activated serine proteases of the coagulation system, and it regulates the blood coagulation cascade.
- Molekulargewicht
- 52 kDa (MW of target protein)
-
