MATN1 Antikörper (Middle Region)
-
- Target Alle MATN1 Antikörper anzeigen
- MATN1 (Matrilin 1, Cartilage Matrix Protein (MATN1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MATN1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Matrilin 1 antibody was raised against the middle region of MATN1
- Aufreinigung
- Affinity purified
- Immunogen
- Matrilin 1 antibody was raised using the middle region of MATN1 corresponding to a region with amino acids KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA
- Top Product
- Discover our top product MATN1 Primärantikörper
-
anti-Matrilin 1, Cartilage Matrix Protein (MATN1) antibody
MATN1 Reaktivität: Human WB, ELISA, ICC Wirt: Maus Monoclonal 5A8 unconjugated
anti-Matrilin 1, Cartilage Matrix Protein (MATN1) (AA 301-400) antibodyMATN1 Reaktivität: Maus WB, ELISA, IHC (p), IF (cc), IF (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Matrilin 1, Cartilage Matrix Protein (MATN1) (AA 376-405), (C-Term) antibodyMATN1 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB32495 unconjugated
anti-Matrilin 1, Cartilage Matrix Protein (MATN1) (N-Term) antibodyMATN1 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Matrilin 1, Cartilage Matrix Protein (MATN1) (AA 1-496) antibodyMATN1 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Matrilin 1, Cartilage Matrix Protein (MATN1) (AA 359-408) antibodyMATN1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Fledermaus, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Matrilin 1, Cartilage Matrix Protein (MATN1) (Middle Region) antibodyMATN1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-Matrilin 1, Cartilage Matrix Protein (MATN1) (C-Term) antibodyMATN1 Reaktivität: Human, Maus, Ratte WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
anti-Matrilin 1, Cartilage Matrix Protein (MATN1) (AA 383-413), (C-Term) antibodyMATN1 Reaktivität: Human WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Matrilin 1 Blocking Peptide, catalog no. 33R-4743, is also available for use as a blocking control in assays to test for specificity of this Matrilin 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MATN1 (Matrilin 1, Cartilage Matrix Protein (MATN1))
- Andere Bezeichnung
- Matrilin 1 (MATN1 Produkte)
- Synonyme
- cmp antikoerper, crtm antikoerper, xmatn1 antikoerper, MGC64509 antikoerper, MGC108367 antikoerper, CMP antikoerper, CRTM antikoerper, Crtm antikoerper, Mat1 antikoerper, matrilin-1 antikoerper, matrilin 1, cartilage matrix protein L homeolog antikoerper, matrilin 1 antikoerper, matrilin 1, cartilage matrix protein antikoerper, matn1.L antikoerper, matn1 antikoerper, MATN1 antikoerper, Matn1 antikoerper
- Hintergrund
- This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins are thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues.
- Molekulargewicht
- 54 kDa (MW of target protein)
-
