MATN1 Antikörper (Middle Region)

Produktnummer ABIN633926

Der Kaninchen Polyklonal anti-MATN1 Antikörper wird verwendet zum Nachweis von MATN1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für MATN1 Antikörper (Middle Region) (ABIN633926)

Target: MATN1 (Matrilin 1, Cartilage Matrix Protein (MATN1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MATN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MATN1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Matrilin 1 antibody was raised against the middle region of MATN1

Aufreinigung: Affinity purified

Immunogen: Matrilin 1 antibody was raised using the middle region of MATN1 corresponding to a region with amino acids KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Matrilin 1 Blocking Peptide, (ABIN940129), is also available for use as a blocking control in assays to test for specificity of this Matrilin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MATN1

Target: MATN1 (Matrilin 1, Cartilage Matrix Protein (MATN1))

Andere Bezeichnung: Matrilin 1

Hintergrund: This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins are thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues.

Molekulargewicht: 54 kDa (MW of target protein)