ART5 Antikörper (Middle Region)

Produktnummer ABIN633917

Produktdetails anti-ART5 Antikörper

Target: ART5 (ADP-Ribosyltransferase 5 (ART5))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ART5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ART5 antibody was raised against the middle region of ART5

Aufreinigung: Affinity purified

Immunogen: ART5 antibody was raised using the middle region of ART5 corresponding to a region with amino acids VFPKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ART5 Blocking Peptide, catalog no. 33R-9536, is also available for use as a blocking control in assays to test for specificity of this ART5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ART5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ART5

Target: ART5 (ADP-Ribosyltransferase 5 (ART5))

Andere Bezeichnung: ART5 (ART5 Produkte)

Synonyme: ARTC5 antikoerper, Yac-2 antikoerper, ART5 antikoerper, Art5 antikoerper, art5 antikoerper, ADP-ribosyltransferase 5 antikoerper, ecto-ADP-ribosyltransferase 5-like antikoerper, ecto-ADP-ribosyltransferase 5 antikoerper, ADP-ribosyltransferase 5 L homeolog antikoerper, ART5 antikoerper, Art5 antikoerper, LOC618664 antikoerper, LOC100715378 antikoerper, art5.L antikoerper

Hintergrund: The protein encoded by this gene belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolog lacks a glycosylphosphatidylinositol-anchor signal sequence and is predicted to be a secretory enzyme. Transcript variants with different 5' UTRs, but encoding the same protein have been found for this gene.

Molekulargewicht: 30 kDa (MW of target protein)