QPCT Antikörper

Produktnummer ABIN633915

Produktdetails anti-QPCT Antikörper

Target: QPCT (Glutaminyl-Peptide Cyclotransferase (QPCT))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser QPCT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: QPCT antibody was raised using a synthetic peptide corresponding to a region with amino acids SRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

QPCT Blocking Peptide, catalog no. 33R-8755, is also available for use as a blocking control in assays to test for specificity of this QPCT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QPCT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu QPCT

Target: QPCT (Glutaminyl-Peptide Cyclotransferase (QPCT))

Andere Bezeichnung: QPCT (QPCT Produkte)

Synonyme: GCT antikoerper, QC antikoerper, sQC antikoerper, QPCT antikoerper, 5730422A13Rik antikoerper, Qpctl1 antikoerper, RGD1562284 antikoerper, qpct antikoerper, glutaminyl-peptide cyclotransferase antikoerper, glutaminyl-peptide cyclotransferase (glutaminyl cyclase) antikoerper, glutaminyl-peptide cyclotransferase L homeolog antikoerper, QPCT antikoerper, Qpct antikoerper, M6_Spy0443 antikoerper, M5005_Spy_0416 antikoerper, M28_Spy0404 antikoerper, CJA_2408 antikoerper, CCNA_02733 antikoerper, Tsp_03182 antikoerper, qpct.L antikoerper

Hintergrund: QPCT is responsible for the biosynthesis of pyroglutamyl peptides. QPCT has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. It also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-beta-amyloid.

Molekulargewicht: 38 kDa (MW of target protein)