CYP2C19 Antikörper (Middle Region)

Produktnummer ABIN633899

Produktdetails anti-CYP2C19 Antikörper

Target: CYP2C19 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 19 (CYP2C19))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP2C19 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYP2 C19 antibody was raised against the middle region of CYP2 19

Aufreinigung: Affinity purified

Immunogen: CYP2 C19 antibody was raised using the middle region of CYP2 19 corresponding to a region with amino acids QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP2C19 Blocking Peptide, catalog no. 33R-7517, is also available for use as a blocking control in assays to test for specificity of this CYP2C19 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 19 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP2C19

Target: CYP2C19 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 19 (CYP2C19))

Andere Bezeichnung: CYP2C19 (CYP2C19 Produkte)

Synonyme: CPCJ antikoerper, CYP2C antikoerper, P450C2C antikoerper, P450IIC19 antikoerper, cytochrome P450 family 2 subfamily C member 19 antikoerper, cytochrome P450, family 2, subfamily C, polypeptide 19 antikoerper, cytochrome P450 2C19 antikoerper, CYP2C19 antikoerper

Hintergrund: CYP2C19 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize many xenobiotics, including the anticonvulsive drug mephenytoin, omeprazole, diazepam and some barbiturates. Polymorphism within this gene is associated with variable ability to metabolize mephenytoin, known as the poor metabolizer and extensive metabolizer phenotypes.

Molekulargewicht: 56 kDa (MW of target protein)