PCCB Antikörper (Middle Region)

Produktnummer ABIN633897

Produktdetails anti-PCCB Antikörper

Target: PCCB (Propionyl CoA Carboxylase beta Polypeptide (PCCB))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCCB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCCB antibody was raised against the middle region of PCCB

Aufreinigung: Affinity purified

Immunogen: PCCB antibody was raised using the middle region of PCCB corresponding to a region with amino acids PGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCCB Blocking Peptide, catalog no. 33R-7102, is also available for use as a blocking control in assays to test for specificity of this PCCB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCCB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCCB

Target: PCCB (Propionyl CoA Carboxylase beta Polypeptide (PCCB))

Andere Bezeichnung: PCCB (PCCB Produkte)

Synonyme: 1300012P06Rik antikoerper, AI314687 antikoerper, R74805 antikoerper, propionyl-CoA carboxylase beta subunit antikoerper, propionyl Coenzyme A carboxylase, beta polypeptide antikoerper, PCCB antikoerper, Pccb antikoerper

Hintergrund: PCCB is a subunit of the propionyl-CoA carboxylase (PCC) enzyme, which is involved in the catabolism of propionyl-CoA. PCC is a mitochondrial enzyme that probably acts as a dodecamer of six alpha subunits and six beta subunits. Defects in this gene are a cause of propionic acidemia type II (PA-2).

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process