OXCT1 Antikörper (Middle Region)
-
- Target Alle OXCT1 Antikörper anzeigen
- OXCT1 (3-Oxoacid CoA Transferase 1 (OXCT1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser OXCT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- OXCT1 antibody was raised against the middle region of OXCT1
- Aufreinigung
- Affinity purified
- Immunogen
- OXCT1 antibody was raised using the middle region of OXCT1 corresponding to a region with amino acids GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLIN
- Top Product
- Discover our top product OXCT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
OXCT1 Blocking Peptide, catalog no. 33R-3442, is also available for use as a blocking control in assays to test for specificity of this OXCT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXCT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OXCT1 (3-Oxoacid CoA Transferase 1 (OXCT1))
- Andere Bezeichnung
- OXCT1 (OXCT1 Produkte)
- Synonyme
- OXCT antikoerper, oxct1 antikoerper, zgc:92003 antikoerper, wu:fj36f06 antikoerper, wu:fj48g08 antikoerper, OXCT1 antikoerper, oxct antikoerper, scot antikoerper, SCOT antikoerper, 2610008O03Rik antikoerper, Oxct antikoerper, Oxct2a antikoerper, Scot-s antikoerper, 3-oxoacid CoA-transferase 1 antikoerper, 3-oxoacid CoA transferase 1a antikoerper, 3-oxoacid CoA transferase 1 antikoerper, 3-oxoacid CoA-transferase 1 L homeolog antikoerper, succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial antikoerper, OXCT1 antikoerper, oxct1a antikoerper, oxct1 antikoerper, Oxct1 antikoerper, oxct1.L antikoerper, MONBRDRAFT_35053 antikoerper, LOC100414476 antikoerper
- Hintergrund
- CT1 is a member of the 3-oxoacid CoA-transferase gene family. It is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate.
- Molekulargewicht
- 52 kDa (MW of target protein)
- Pathways
- Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis
-