CYP1B1 Antikörper (Middle Region)
-
- Target Alle CYP1B1 Antikörper anzeigen
- CYP1B1 (Cytochrome P450, Family 1, Subfamily B, Polypeptide 1 (CYP1B1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CYP1B1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CYP1 B1 antibody was raised against the middle region of CYP1 1
- Aufreinigung
- Affinity purified
- Immunogen
- CYP1 B1 antibody was raised using the middle region of CYP1 1 corresponding to a region with amino acids AVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQY
- Top Product
- Discover our top product CYP1B1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CYP1B1 Blocking Peptide, catalog no. 33R-1584, is also available for use as a blocking control in assays to test for specificity of this CYP1B1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP1B1 (Cytochrome P450, Family 1, Subfamily B, Polypeptide 1 (CYP1B1))
- Andere Bezeichnung
- CYP1B1 (CYP1B1 Produkte)
- Synonyme
- CP1B antikoerper, CYPIB1 antikoerper, GLC3A antikoerper, P4501B1 antikoerper, P4501b1 antikoerper, CYP1B1 antikoerper, CYP1B antikoerper, zgc:136223 antikoerper, cytochrome P450 family 1 subfamily B member 1 antikoerper, cytochrome P450, family 1, subfamily b, polypeptide 1 antikoerper, cytochrome P450, family 1, subfamily B, polypeptide 1 antikoerper, cytochrome P450 1B1 antikoerper, CYP1B1 antikoerper, Cyp1b1 antikoerper, cyp1b1 antikoerper, LOC100719054 antikoerper
- Hintergrund
- CYP1B1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. CYP1B1 localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma, therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid.
- Molekulargewicht
- 61 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-