Afamin Antikörper (Middle Region)

Produktnummer ABIN633872

Produktdetails anti-Afamin Antikörper

Target: Afamin (AFM)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Afamin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Afamin antibody was raised against the middle region of AFM

Aufreinigung: Affinity purified

Immunogen: Afamin antibody was raised using the middle region of AFM corresponding to a region with amino acids GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSR

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Afamin Blocking Peptide, catalog no. 33R-3492, is also available for use as a blocking control in assays to test for specificity of this Afamin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AFM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Afamin

Target: Afamin (AFM)

Andere Bezeichnung: Afamin (AFM Produkte)

Synonyme: AFM antikoerper, ALB2 antikoerper, ALBA antikoerper, ALF antikoerper, Alf antikoerper, alpha-Alb antikoerper, afamin antikoerper, AFM antikoerper, Afm antikoerper

Hintergrund: AFM is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. AFM is regulated developmentally, expressed in the liver and secreted into the bloodstream.

Molekulargewicht: 69 kDa (MW of target protein)