SLIT1 Antikörper
-
- Target Alle SLIT1 Antikörper anzeigen
- SLIT1 (Slit Homolog 1 (SLIT1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLIT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLIT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC
- Top Product
- Discover our top product SLIT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLIT1 Blocking Peptide, catalog no. 33R-3156, is also available for use as a blocking control in assays to test for specificity of this SLIT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLIT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLIT1 (Slit Homolog 1 (SLIT1))
- Andere Bezeichnung
- SLIT1 (SLIT1 Produkte)
- Synonyme
- Slil1 antikoerper, mKIAA0813 antikoerper, MEGF4 antikoerper, SLIL1 antikoerper, SLIT-1 antikoerper, SLIT3 antikoerper, megf4 antikoerper, slil1 antikoerper, slit-1 antikoerper, SLIT1 antikoerper, slit3 antikoerper, slit homolog 1 (Drosophila) antikoerper, slit guidance ligand 1 antikoerper, slit guidance ligand 1 S homeolog antikoerper, slit homolog 1 protein antikoerper, slit homolog 1b (Drosophila) antikoerper, slit homolog 1a (Drosophila) antikoerper, Slit1 antikoerper, SLIT1 antikoerper, slit1.S antikoerper, slit1 antikoerper, LOC100459557 antikoerper, slit1b antikoerper, slit1a antikoerper
- Hintergrund
- SLIT1 is thought to act as molecular guidance cue in cellular migration, and function appears to be mediated by interaction with roundabout homolog receptors.
- Molekulargewicht
- 168 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-