SLIT1 Antikörper

Produktnummer ABIN633869

Produktdetails anti-SLIT1 Antikörper

Target: SLIT1 (Slit Homolog 1 (SLIT1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLIT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLIT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLIT1 Blocking Peptide, catalog no. 33R-3156, is also available for use as a blocking control in assays to test for specificity of this SLIT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLIT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLIT1

Target: SLIT1 (Slit Homolog 1 (SLIT1))

Andere Bezeichnung: SLIT1 (SLIT1 Produkte)

Synonyme: Slil1 antikoerper, mKIAA0813 antikoerper, MEGF4 antikoerper, SLIL1 antikoerper, SLIT-1 antikoerper, SLIT3 antikoerper, megf4 antikoerper, slil1 antikoerper, slit-1 antikoerper, SLIT1 antikoerper, slit3 antikoerper, slit homolog 1 (Drosophila) antikoerper, slit guidance ligand 1 antikoerper, slit guidance ligand 1 S homeolog antikoerper, slit homolog 1 protein antikoerper, slit homolog 1b (Drosophila) antikoerper, slit homolog 1a (Drosophila) antikoerper, Slit1 antikoerper, SLIT1 antikoerper, slit1.S antikoerper, slit1 antikoerper, LOC100459557 antikoerper, slit1b antikoerper, slit1a antikoerper

Hintergrund: SLIT1 is thought to act as molecular guidance cue in cellular migration, and function appears to be mediated by interaction with roundabout homolog receptors.

Molekulargewicht: 168 kDa (MW of target protein)

Pathways: Regulation of Cell Size