MMP13 Antikörper

Produktnummer ABIN633868

Produktdetails anti-MMP13 Antikörper

Target: MMP13 (Matrix Metallopeptidase 13 (Collagenase 3) (MMP13))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MMP13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: MMP13 antibody was raised using a synthetic peptide corresponding to a region with amino acids HFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MMP13 Blocking Peptide, catalog no. 33R-3728, is also available for use as a blocking control in assays to test for specificity of this MMP13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MMP13

Target: MMP13 (Matrix Metallopeptidase 13 (Collagenase 3) (MMP13))

Andere Bezeichnung: MMP13 (MMP13 Produkte)

Synonyme: CLG3 antikoerper, MANDP1 antikoerper, Clg antikoerper, MMP-13 antikoerper, Mmp1 antikoerper, cb1034 antikoerper, mmp13 antikoerper, gene A antikoerper, xCol antikoerper, xcl3 antikoerper, MMP13 antikoerper, MGC108008 antikoerper, matrix metallopeptidase 13 antikoerper, matrix metallopeptidase 13a antikoerper, matrix metallopeptidase 13 (collagenase 3) like S homeolog antikoerper, matrix metallopeptidase 13 (collagenase 3) antikoerper, matrix metalloproteinase 13 antikoerper, matrix metallopeptidase 13 (collagenase 3) like L homeolog antikoerper, MMP13 antikoerper, Mmp13 antikoerper, mmp13a antikoerper, mmp13l.S antikoerper, mmp13 antikoerper, LOC100136348 antikoerper, mmp13l.L antikoerper

Hintergrund: Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes.

Molekulargewicht: 42 kDa (MW of target protein)