Manic Fringe Antikörper (Middle Region)
-
- Target Alle Manic Fringe (MFNG) Antikörper anzeigen
- Manic Fringe (MFNG) (MFNG)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Manic Fringe Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MFNG antibody was raised against the middle region of MFNG
- Aufreinigung
- Affinity purified
- Immunogen
- MFNG antibody was raised using the middle region of MFNG corresponding to a region with amino acids MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETL
- Top Product
- Discover our top product MFNG Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MFNG Blocking Peptide, catalog no. 33R-5720, is also available for use as a blocking control in assays to test for specificity of this MFNG antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFNG antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Manic Fringe (MFNG) (MFNG)
- Andere Bezeichnung
- MFNG (MFNG Produkte)
- Synonyme
- AW546563 antikoerper, MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase antikoerper, MFNG antikoerper, Mfng antikoerper
- Hintergrund
- MFNG is one of the evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. This gene is a member of the fringe gene family which also includes Radical and Lunatic fringe. They all encode evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta1,3 N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling.
- Molekulargewicht
- 36 kDa (MW of target protein)
- Pathways
- Notch Signalweg
-