HS2ST1 Antikörper (N-Term)
-
- Target Alle HS2ST1 Antikörper anzeigen
- HS2ST1 (Heparan Sulfate 2-O-Sulfotransferase 1 (HS2ST1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HS2ST1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HS2 ST1 antibody was raised against the N terminal of HS2 T1
- Aufreinigung
- Affinity purified
- Immunogen
- HS2 ST1 antibody was raised using the N terminal of HS2 T1 corresponding to a region with amino acids GLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVR
- Top Product
- Discover our top product HS2ST1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HS2ST1 Blocking Peptide, catalog no. 33R-3410, is also available for use as a blocking control in assays to test for specificity of this HS2ST1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HS2ST1 (Heparan Sulfate 2-O-Sulfotransferase 1 (HS2ST1))
- Andere Bezeichnung
- HS2ST1 (HS2ST1 Produkte)
- Synonyme
- HS2ST1 antikoerper, hs2st antikoerper, dJ604K5.2 antikoerper, AW214369 antikoerper, Hs2st antikoerper, mKIAA0448 antikoerper, CHS2ST antikoerper, HS2ST antikoerper, 2-OST antikoerper, 2OST antikoerper, HS2st antikoerper, hs2st1 antikoerper, im:7147474 antikoerper, zgc:158230 antikoerper, heparan sulfate 2-O-sulfotransferase 1 antikoerper, Heparan sulfate 2-O-sulfotransferase 1 antikoerper, heparan sulfate 2-O-sulfotransferase 1 L homeolog antikoerper, heparan sulfate 2-O-sulfotransferase 1a antikoerper, HS2ST1 antikoerper, Tsp_05909 antikoerper, hs2st1 antikoerper, hs2st antikoerper, Hs2st1 antikoerper, hs2st1.L antikoerper, hs2st1a antikoerper
- Hintergrund
- Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. HS2ST1 is a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation.
- Molekulargewicht
- 42 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process, Tube Formation, SARS-CoV-2 Protein Interaktom
-