ECHDC2 Antikörper (Middle Region)
-
- Target Alle ECHDC2 Produkte
- ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ECHDC2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ECHDC2 antibody was raised against the middle region of ECHDC2
- Aufreinigung
- Affinity purified
- Immunogen
- ECHDC2 antibody was raised using the middle region of ECHDC2 corresponding to a region with amino acids TQRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQR
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ECHDC2 Blocking Peptide, catalog no. 33R-9249, is also available for use as a blocking control in assays to test for specificity of this ECHDC2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))
- Andere Bezeichnung
- ECHDC2 (ECHDC2 Produkte)
- Synonyme
- NV16396 antikoerper, id:ibd1032 antikoerper, wu:fc83b02 antikoerper, zgc:56321 antikoerper, zgc:85763 antikoerper, RGD1308525 antikoerper, 1300017C12Rik antikoerper, 2610009M20Rik antikoerper, D4Ertd765e antikoerper, enoyl-CoA hydratase domain containing 2 antikoerper, methylglutaconyl-CoA hydratase, mitochondrial antikoerper, enoyl CoA hydratase domain containing 2 antikoerper, enoyl Coenzyme A hydratase domain containing 2 antikoerper, ECHDC2 antikoerper, echdc2 antikoerper, LOC100121877 antikoerper, Echdc2 antikoerper
- Hintergrund
- ECHDC2 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC2 remains unknown.
- Molekulargewicht
- 28 kDa (MW of target protein)
-