SERPIND1 Antikörper

Produktnummer ABIN633840

Produktdetails anti-SERPIND1 Antikörper

Target: SERPIND1 (serpin Peptidase Inhibitor, Clade D (Heparin Cofactor), Member 1 (SERPIND1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SERPIND1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SERPIND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SERPIND1 Blocking Peptide, catalog no. 33R-9813, is also available for use as a blocking control in assays to test for specificity of this SERPIND1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPIND1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SERPIND1

Target: SERPIND1 (serpin Peptidase Inhibitor, Clade D (Heparin Cofactor), Member 1 (SERPIND1))

Andere Bezeichnung: SERPIND1 (SERPIND1 Produkte)

Synonyme: D22S673 antikoerper, HC2 antikoerper, HCF2 antikoerper, HCII antikoerper, HLS2 antikoerper, LS2 antikoerper, THPH10 antikoerper, serpind1 antikoerper, MGC53936 antikoerper, rls2var1 antikoerper, AA985900 antikoerper, AI303446 antikoerper, Hcf2 antikoerper, serpin family D member 1 antikoerper, serpin peptidase inhibitor, clade D (heparin cofactor), member 1 L homeolog antikoerper, serpin peptidase inhibitor, clade D (heparin cofactor), member 1 antikoerper, serine (or cysteine) peptidase inhibitor, clade D, member 1 antikoerper, SERPIND1 antikoerper, serpind1.L antikoerper, Serpind1 antikoerper, serpind1 antikoerper

Hintergrund: The product encoded by this gene is a serine proteinase inhibitor which rapidly inhibits thrombin in the presence of dermatan sulfate or heparin. The gene contains five exons and four introns.

Molekulargewicht: 55 kDa (MW of target protein)