C21orf62 Antikörper (Middle Region)

Produktnummer ABIN633839

Produktdetails anti-C21orf62 Antikörper

Target: C21orf62 (Chromosome 21 Open Reading Frame 62 (C21orf62))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C21orf62 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C21 ORF62 antibody was raised against the middle region of C21 rf62

Aufreinigung: Affinity purified

Immunogen: C21 ORF62 antibody was raised using the middle region of C21 rf62 corresponding to a region with amino acids STNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLIHSGGDSDSREKPMWL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C21ORF62 Blocking Peptide, catalog no. 33R-8879, is also available for use as a blocking control in assays to test for specificity of this C21ORF62 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF62 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C21orf62

Target: C21orf62 (Chromosome 21 Open Reading Frame 62 (C21orf62))

Andere Bezeichnung: C21ORF62 (C21orf62 Produkte)

Synonyme: B37 antikoerper, PRED81 antikoerper, C21orf120 antikoerper, MGC88933 antikoerper, chromosome 21 open reading frame 62 antikoerper, chromosome 1 open reading frame, human C21orf62 antikoerper, chromosome 3 open reading frame, human C21orf62 antikoerper, C21orf62 antikoerper, C1H21ORF62 antikoerper, c21orf62 antikoerper, C3H21orf62 antikoerper

Hintergrund: The function of C21orf62 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 28 kDa (MW of target protein)